PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1KG109600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 229aa    MW: 25296.3 Da    PI: 5.2233
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1KG109600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.41.6e-27959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krie+   rqvtfskRr g++KKAeELSvLCda+va+i+fsstgkl  ++s
  Pavir.1KG109600.1.p  9 KRIESAAARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSTGKLSQFAS 59
                         79*********************************************9986 PP

2K-box58.72.5e-20911711999
                K-box  19 qelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                           ++a L++++ +    +R++ Ge+Le Ls++eLqqLe++Le +l ++ ++K++ +leqi elq+k  +l een++Lr+++ 
  Pavir.1KG109600.1.p  91 SKYASLNEQLAEASLRLRQMRGEELEGLSVEELQQLEKNLEAGLHRVLQTKDQQFLEQIGELQRKSSQLAEENTQLRNQVS 171
                          45666777777777899************************************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.623161IPR002100Transcription factor, MADS-box
SMARTSM004322.0E-36160IPR002100Transcription factor, MADS-box
CDDcd002652.06E-39275No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-25323IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.32E-30374IPR002100Transcription factor, MADS-box
PfamPF003191.7E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-253859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129714.06686176IPR002487Transcription factor, K-box
PfamPF014869.1E-1892170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009910Biological Processnegative regulation of flower development
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0030154Biological Processcell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048438Biological Processfloral whorl development
GO:0005634Cellular Componentnucleus
GO:0000900Molecular Functiontranslation repressor activity, nucleic acid binding
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MARERREIKR IESAAARQVT FSKRRRGLFK KAEELSVLCD ADVALIVFSS TGKLSQFASS  60
SMNEIIDKYN THSKNLGKAE PPSLDLNLEH SKYASLNEQL AEASLRLRQM RGEELEGLSV  120
EELQQLEKNL EAGLHRVLQT KDQQFLEQIG ELQRKSSQLA EENTQLRNQV SQIPPSGKQA  180
VADTENVIAE DGQSSESVMT ALHSGSSQDN DDGSDVSLKL GLPCVGWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S5e-19173173Myocyte-specific enhancer factor 2B
1tqe_R5e-19173173Myocyte-specific enhancer factor 2B
1tqe_Q5e-19173173Myocyte-specific enhancer factor 2B
1tqe_P5e-19173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.6290.0leaf| root| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00272DAPTransfer from AT2G22540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0354200.0BT035420.1 Zea mays full-length cDNA clone ZM_BFb0060F04 mRNA, complete cds.
GenBankKJ7269230.0KJ726923.1 Zea mays clone pUT3468 MADS transcription factor (MADS73) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953998.11e-159PREDICTED: MADS-box transcription factor 22
SwissprotQ9XJ661e-145MAD22_ORYSJ; MADS-box transcription factor 22
TrEMBLB4FE821e-156B4FE82_MAIZE; MADS transcription factor
TrEMBLK3YTC91e-155K3YTC9_SETIT; Uncharacterized protein
STRINGSb04g033930.11e-158(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12213697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.12e-64MIKC_MADS family protein